SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002786 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002786
Domain Number 1 Region: 160-232
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-17
Family Complement control module/SCR domain 0.00038
Further Details:      
 
Domain Number 2 Region: 221-293
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.12e-16
Family Complement control module/SCR domain 0.00016
Further Details:      
 
Domain Number 3 Region: 281-344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000764
Family Complement control module/SCR domain 0.0009
Further Details:      
 
Domain Number 4 Region: 34-101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000391
Family Complement control module/SCR domain 0.00011
Further Details:      
 
Domain Number 5 Region: 95-170
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000126
Family Complement control module/SCR domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002786   Gene: ENSMODG00000002282   Transcript: ENSMODT00000002841
Sequence length 544
Comment pep:known_by_projection chromosome:BROADO5:2:113871638:113899037:1 gene:ENSMODG00000002282 transcript:ENSMODT00000002841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPASHRAPPTLGHPGLLSLLLLLLYLSKAHGECNIPPDIPNAKPELNGVTSFPVDTTVT
YKCNEGFVKMPGKSDSLVCLQTNKWSKLSEFCNRTCDVPPLLRFASLKKQFSKQNYFPVG
SVVQYECRPGYKRDPSLPAKLTCLQNVVWSNASEFCKRKSCPTPPELLHGHVDIATDILL
GSVITYTCNEGYRLLGAEDSHCIFMDKNVVWSPPPPECTEILCQEPPKIVNGEIQGNQDS
YKYGSSVTYTCDKNLSLIGEKSIHCTVKDEQGEWSSPPPQCKDVRCENPIVPNGQKKSPS
KPPYRYQDTLIFDCNPGFILVGNSTIQCGSDNKWTPGIPLCKGITTVAPTTVKKLTTTNA
PATEAPPTQQVNPTNAPTTKEQSLTEQANATSSPTTEVPPTMQQANPTNAPQTKSPPPIQ
QVNVTNVATTPTPTTSKRSTTTTQSSTKIVTTLRPFKTTSFHTTRRVTEMSAKRTTPSGA
ATSFSGIVGGLIVMAVLIVLPVFVKLLYNYGKSGSYNIHEISKELYVVLSDKMETGKPTE
EIHI
Download sequence
Identical sequences F7CVM1
ENSMODP00000002786 ENSMODP00000002786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]