SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002817 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002817
Domain Number 1 Region: 297-391
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.9e-21
Family Canonical RBD 0.000011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002817
Domain Number - Region: 82-150
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0146
Family DNA-binding N-terminal domain of transcription activators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002817   Gene: ENSMODG00000002312   Transcript: ENSMODT00000002873
Sequence length 415
Comment pep:known_by_projection chromosome:BROADO5:X:12254011:12293108:1 gene:ENSMODG00000002312 transcript:ENSMODT00000002873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRINSSLSSDDLILEDLETEGERQLRSLLHHQLDTSVSVEECVSKKQCFAPAAVYKPFG
EEAAGALSLSQFQALQKSDQEISSLRDLGLNDREIILWKNRASSERGRGLGAAPEATQDR
LRDIEEKISEHQRILALPQRFAGSKQLSRREMEIEKALFQGNDRHSFLRALYYQGESHKR
LEAEKDPINNLETVYQEMMAKPHPEEAQLMRGEPFACPSLDSDVLVDSSGPSKNLSVLED
QGNQAAQAEGSSLHVVKAIESEPQQCLNEPKKLTEVVDFVSEDDIERNRLSEEDIRKIPM
FASYSPGEPNKVLYLKNLSPRVTEKELVSLFARFQEKKGPLIQFRVLTGRMKGQAFVTFP
NMEMAQQALLLVNGYNLLGKTLVIEFGKNKTQMPGLQSASPIPCATDSMTERNGS
Download sequence
Identical sequences F6YDN9
ENSMODP00000002817 XP_007507074.1.35504 ENSMODP00000002817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]