SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002821 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002821
Domain Number 1 Region: 29-201
Classification Level Classification E-value
Superfamily L domain-like 2.49e-33
Family Internalin LRR domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002821   Gene: ENSMODG00000002315   Transcript: ENSMODT00000002877
Sequence length 264
Comment pep:known_by_projection chromosome:BROADO5:1:68817523:68849606:-1 gene:ENSMODG00000002315 transcript:ENSMODT00000002877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGKGPKGKKITLKVAKNCIKVTFDGRKRLDLSKMGITTFPKCILKLNDVDELDMSRNM
IKKIPDSINKFQNLRWLDLHSNFIEKLPDTIGELASLHYLNLCNNKLTTNTLPVELKELK
NLRVLNLGLNHIDNIPTTLGQLKELHEMGAFDNLLTTIPTSIAKLPKLKKLNVKRNPFPQ
EDDSAEFIDSIKRLESLYLVEAKDLCGPCLKKCQDARDKLNKIKSMAPAQARKPNFINLI
NPNSTAKESQEEWRMSQSLLELPS
Download sequence
Identical sequences F6YDB8
ENSMODP00000002821 ENSMODP00000002821 XP_001365953.2.35504 XP_007478660.1.35504 XP_007478661.1.35504 XP_007478662.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]