SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002891 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002891
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.55e-24
Family Canonical RBD 0.0000203
Further Details:      
 
Domain Number 2 Region: 84-197
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-19
Family Canonical RBD 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002891   Gene: ENSMODG00000002376   Transcript: ENSMODT00000002948
Sequence length 248
Comment pep:novel chromosome:BROADO5:3:106225724:106226997:-1 gene:ENSMODG00000002376 transcript:ENSMODT00000002948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWKLFIRGLSFERTDESPQSHFKQWDTLTDCVMMRDPNTKQSRGFAFVTYTTVEEINAVM
NARPHKFDGRVIEPKRDISREDSQRPGTDLTVKKIFVGGIKEDTKEHHRDYFEQYGKIKV
IEIMTDRGIDKKKGFAFVTFDGHDSALDKIVFQKYHTVNGHNCEVRKALSKQEMASASSS
QGGLSSGGSYNDFSNYNNQSSNFGPMRRGNFGGRSSGPYGGNQYFAKPHNQGGYGGSSSS
NSYSSADF
Download sequence
Identical sequences F7G312
13616.ENSMODP00000002891 ENSMODP00000002891 ENSMODP00000002891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]