SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002956 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002956
Domain Number 1 Region: 3-289
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.48e-55
Family CAF1-like ribonuclease 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002956   Gene: ENSMODG00000002430   Transcript: ENSMODT00000003015
Sequence length 481
Comment pep:known_by_projection chromosome:BROADO5:2:9383875:9386118:-1 gene:ENSMODG00000002430 transcript:ENSMODT00000003015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVPVVDVQIDNFKDMWPSILLAIQTASFVAVDTELSGLGERKNLLDHCIEERYKAVAKA
ARTRSVLSLGLACFRQQITKADHSYLVQVFNLTLLCMQEYIIEPQSVQFLVQHGFDFNRQ
YTQGIPYHKGNDKGNDSQIQGVRMLFLELIRARRPLVLHNGLIDLAFLYESFYAHLPDKL
VTFTADLFEMFPAGIYDTKYAAEFQARFVASYLEYAYRKCERENGKQQIAGAPHVVLDFC
RYPSSMDSHIDYRGCSTPRARTHLSSNLATSGICDTFSAYGWCPLGLQCPLSHDVDLIIS
TDEAMEDKRRRRGRRRKRWKARQGRTGPLPTDGPTPTKQTCREGLGIEWEDGNNPLGDED
EGEVEFNAEAEGEFDAEAEGEAETEEELELRPRERPRSRGPNIGGGLHRAGFDAFMTGYV
MAYLGLSKNSKPSSHDQLWLPECHNKVYLSGKAVPLPIAKSHFSRTSKAHNEKMKLAWGC
S
Download sequence
Identical sequences F7E0E0
ENSMODP00000002956 13616.ENSMODP00000002956 ENSMODP00000002956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]