SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002993 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002993
Domain Number 1 Region: 5-103
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.12e-25
Family Canonical RBD 0.00013
Further Details:      
 
Domain Number 2 Region: 94-177
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.17e-24
Family Canonical RBD 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002993   Gene: ENSMODG00000002463   Transcript: ENSMODT00000003055
Sequence length 188
Comment pep:novel chromosome:BROADO5:X:74351465:74352028:1 gene:ENSMODG00000002463 transcript:ENSMODT00000003055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSAQLCKLFVGGLSPYTTEIRLRSYFEAFGCLRDCVVVMNAQTNRSRCFGFITFSSLSEA
DAAMAASPHEVDGSRVELKRAVSREDSCKPGAHARVKKIFVGGIKGDVSESDLVRHFSQF
GPVEKAEIIVNKQSGKKRGFGFVHFFDHDTADKAAVIKFHPIQGHRVEVKKALPKEDLDQ
WNFNLPML
Download sequence
Identical sequences F7DDS6
13616.ENSMODP00000002993 ENSMODP00000002993 ENSMODP00000002993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]