SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003000 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003000
Domain Number 1 Region: 554-667
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-28
Family Canonical RBD 0.0019
Further Details:      
 
Domain Number 2 Region: 368-467
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-23
Family Canonical RBD 0.00012
Further Details:      
 
Domain Number 3 Region: 461-547
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-20
Family Canonical RBD 0.0034
Further Details:      
 
Domain Number 4 Region: 282-371
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000116
Family Canonical RBD 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003000   Gene: ENSMODG00000002470   Transcript: ENSMODT00000003063
Sequence length 702
Comment pep:known_by_projection chromosome:BROADO5:2:536432084:536440080:-1 gene:ENSMODG00000002470 transcript:ENSMODT00000003063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLGKAAKNQGEPKKMAPPPKEVEDSEDEDMSEEEEESSGEEVVVPQKKGKKAAATPAK
KAAATPAKKAVVATTPAKKAVVTPGKKAAVTPAKKVATPAKAVPTPGKKGGKAAATPAKG
AKNGKNAKKEDSESEEEDSEDEDDEEFEPPKAAKGGAALSKQDSEEEEDDDEEEEDSEEE
EEEDEDDSEEEAMDTTPAKGKAASVKAAKGGKAKESEEEEEDDEDEEEDDEEEEEDEEEE
EEEEEEEEEEEEEEEVPVKEAPGKRKKEMGKQKAPEAKKQKLEAETSTNFNLFAGNLNFN
KTAAELKTAITDFFAKKDLTVVDVRIGATRKFGYVEFESAEDMEKALELSGSKVLGSEMK
LEKAKENKKDRDARTLFVKNLPYKVTQEELKEVFEDAIEIRLVCTKDGTPKGIAYVEFKT
EADVDKALEEKQGTEIDGRALILDYTGEKSQGQENSRGKNNSWSGNNSKPSDSKTLVLNN
LAYSATEESLQEVFEKATSISLPQNNQGRPKGYAFIEFASVEDAKEALNSCNNIEIEGRA
IRLELKGQKTANAAPRNQSNKTLFVKGLSEDTTEETLKDSFHGSVGARIATDRETGSSKG
FGFVDFNSEEEAKAAKEAMEDGEIDGNKVTLDWAKPSGFGGRGGGRGGGGRGGFGGRGGG
RGGRGGFGGRGRGGNFGGRGGFRGGRGGGGDNKPQGKKTKFE
Download sequence
Identical sequences F7BWB5
XP_007486139.1.35504 ENSMODP00000003000 ENSMODP00000003000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]