SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003094 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003094
Domain Number 1 Region: 277-371
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-27
Family SH2 domain 0.00044
Further Details:      
 
Domain Number 2 Region: 116-167
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-21
Family SH3-domain 0.00083
Further Details:      
 
Domain Number 3 Region: 191-293
Classification Level Classification E-value
Superfamily SH3-domain 8.79e-21
Family SH3-domain 0.0000327
Further Details:      
 
Domain Number 4 Region: 5-60
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-18
Family SH3-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003094   Gene: ENSMODG00000002546   Transcript: ENSMODT00000003160
Sequence length 380
Comment pep:known_by_projection chromosome:BROADO5:7:70348491:70474210:1 gene:ENSMODG00000002546 transcript:ENSMODT00000003160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANKTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTKRKTSTRDASPTPSTDAEYPSNGSTADRIYDLNIPAYVKF
AYVAEREDELSLVKGSRVIVMEKCSDGWWRGSYNGQIGWFPSNYVVEELEEATADSPSFL
SLRKGASMSNGQSMKVLHIVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNS
RGLIGLVPKNYVVILSDGPAMNTSHPPQISYTGPSSTGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLVRDSESSPSDFSVSLKASGKNKHFKVQLLDNVYCIGQRRFHTMDELVEHYK
KAPIFTSEHGEKLYLIKALQ
Download sequence
Identical sequences F7ALW1
ENSMODP00000003094 ENSMODP00000003094 XP_007501248.1.35504 XP_007501249.1.35504 XP_007501250.1.35504 XP_007501251.1.35504 13616.ENSMODP00000003094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]