SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003205 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003205
Domain Number 1 Region: 10-148,181-226
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.75e-31
Family DnaQ-like 3'-5' exonuclease 0.0000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003205   Gene: ENSMODG00000002644   Transcript: ENSMODT00000003273
Sequence length 234
Comment pep:known_by_projection chromosome:BROADO5:2:10144307:10280948:1 gene:ENSMODG00000002644 transcript:ENSMODT00000003273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMAAIPPQRYHYFLVLDFEATCDKPQIHPQEIIEFPILKLNGQTMEIESTFHMYVQPA
VHPQLTPFCTELTGIIQGMVDGQPSLQQVLERVDEWMAKEGLLDPSVKSIFVTCGDWDLK
VMLPGQCHYLGLPVADYFKQWINLKKVPEGGRVQGREASKRVWATINQAPLLFQAYSFAM
GSWPKNGLLDMNKGLNLQHIGRPHSGIDDCKNIANIMKTLAHRGFIFKQTSKPF
Download sequence
Identical sequences F7DIF2
ENSMODP00000003205 ENSMODP00000003205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]