SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003337 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003337
Domain Number 1 Region: 221-331
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-24
Family Canonical RBD 0.0038
Further Details:      
 
Domain Number 2 Region: 331-442
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.36e-23
Family Canonical RBD 0.0023
Further Details:      
 
Domain Number 3 Region: 644-713
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000578
Family Canonical RBD 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003337   Gene: ENSMODG00000002744   Transcript: ENSMODT00000003406
Sequence length 715
Comment pep:known_by_projection chromosome:BROADO5:1:178161846:178196342:-1 gene:ENSMODG00000002744 transcript:ENSMODT00000003406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWVLGDKRSYLPYLPNSPPSPRERGQSGCSGSALLVRQSQGMALAAAHLADPRQFPPSH
LAPISPHHLPHPLPDQCRPVLARSGQPSARGLFKSGSVTASPATAIVALGAPLSVGGGGS
GGMAETDKPEVPGVAGDDTPRQQLSPPEQLEESGQEQLQPQQELEKQQPPPHGGSSNGVK
MENDDSVKEEKSDLKEKSTGNKKANRFHPYSKDKNSGTGEKKGPNRNRVFISNIPYDMKW
QAIKDLMREKVGEVTYVELFKDSEGKSRGCGVVEFKDEEFVKKALETMNKYDLSGRPLNI
KEDPDGENARRALQRTGGSFPGGHVPDMGSGLMNLPPSILNNPNIPPEVISNLQAGRLGS
TIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMGTVTFDQAIEAVQAISMF
NGQFLFDRPMHVKMDDKSVPHEDYRSHDSKTPQLPRNDCIIGNLLTICGQPISANQLSMG
GGMGNIGPGSMGMDGPGFGGMNRMGGGVGFGGMETMNNMGGFGGISRMGELYRGGMTSSM
ERDFGRGDIGMNRGFGDSFGRIGGAMIGGFAGGMGASNMGPVGSGMSRNSSSSPSSNWYG
LEYTTNSNAAIFPSFDCHLTKSVRLKKKRMNDPGYYIVYIMIKELKEKDLYRPLKIKFEQ
VSHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRNA
Download sequence
Identical sequences F6Z6V9
ENSMODP00000003337 ENSMODP00000003337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]