SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003400 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003400
Domain Number 1 Region: 191-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-51
Family DBL homology domain (DH-domain) 0.000000342
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.5e-39
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 5.84e-33
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 636-765
Classification Level Classification E-value
Superfamily SH2 domain 3.18e-27
Family SH2 domain 0.00058
Further Details:      
 
Domain Number 5 Region: 781-844
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-21
Family SH3-domain 0.0008
Further Details:      
 
Domain Number 6 Region: 583-664
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000394
Family SH3-domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003400   Gene: ENSMODG00000002796   Transcript: ENSMODT00000003471
Sequence length 846
Comment pep:known_by_projection chromosome:BROADO5:2:476500052:476945982:-1 gene:ENSMODG00000002796 transcript:ENSMODT00000003471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWRQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLKGHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESVNDEEIYKGLPDLIDETRADDEEDLYDCVYGEDEGGEVYEDLMKAE
EAQQPKCLENDIRSCCLAEIKQTEEKYTETLESIEKYFMTPLKRFLTATEFDTVFINIPE
LVKVHRSLTQEINDSIVNKNDQNLYQIFINYKERLVIYGQYCSGVESAISGLDFISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDSTEKANLKQALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLVFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKACQMLLRGTFYQ
GYLCFKCGARAHKECLGRLDNCGRVNSGEQGTLKPEKPRNGLRRPPRQVDPGLPKMQVIK
NYTGNPQPPQQEGPPLHIQLGDTVELLRGDAHSLFWQGRNLASGEIGFFPSEAVKPCPCV
PKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKI
LTRDGFFHIAENRRFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPENTAGQRGNRAS
SNLLSPKVLGIAIARYDFCARDMRELSLSKGDMVKIYTKMSVNGWWRGEANGRVGWFPST
YVEEDE
Download sequence
Identical sequences F7EJL2
ENSMODP00000003400 13616.ENSMODP00000003400 XP_001372356.1.35504 ENSMODP00000003400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]