SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003430 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003430
Domain Number 1 Region: 9-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.85e-20
Family Canonical RBD 0.00000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003430   Gene: ENSMODG00000002819   Transcript: ENSMODT00000003501
Sequence length 286
Comment pep:novel chromosome:BROADO5:1:387360960:387430588:1 gene:ENSMODG00000002819 transcript:ENSMODT00000003501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKVHTSNITNKNDPKSLNSRVFIGNLNTAMVKKADVETIFSKYGRVAGCSVHKGYAFV
QYASERHARAAVLGENGRVLAGQTLDINMAGEPKPNRPKGLKRAASASYGLPLPTPFLGG
YVFYSNYFREDLYDRLFEPRGRLSPVPRVVPVKRPRVTIPLVRRIKATLPVRLFARSTTS
NSSTKLKLKCTELQTIKTELTQIKYNIEALLGRLDQISEEQSPGTDGKKKSDGKKSEAIQ
EDTASEAETPLEELLPGDEGDEALAQDDFEDLDNSRYTELDELTLQ
Download sequence
Identical sequences F7EJ60
ENSMODP00000003430 ENSMODP00000003430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]