SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003431 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003431
Domain Number 1 Region: 349-406
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-20
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 2 Region: 635-906,943-1092
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.82e-18
Family Hermes transposase-like 0.0062
Further Details:      
 
Domain Number 3 Region: 29-82
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000759
Family KRAB domain (Kruppel-associated box) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003431   Gene: ENSMODG00000002820   Transcript: ENSMODT00000003502
Sequence length 1212
Comment pep:known_by_projection chromosome:BROADO5:8:214269870:214310499:1 gene:ENSMODG00000002820 transcript:ENSMODT00000003502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWENFGGGGPVEGSAQPEDSRAMESGESGQMLVTFDDITVYLLQEEWMLLGEQQKEICGS
DNLVSPLGSPIANPELFCKLEREVEPWLGDASGQRKPLNRHLGKNKRKSMGEIDIQGPTR
EVGLYLPSQKKTHLSHAVSDCVEDDSTGKVRKILRPRSIQKSWFQQFPWLITNEEQTALF
CSACREYPSVRDKRSRLIEGYTGPFKVETLKYHAKSKAHKFCINALAARDPVWATRFESI
RETSEDLLTSAEHLFNTDYPMLYPPGSLGDYDSLVELLPDSGSELGNSTDNGTASALYLD
CVSDVRQDIINDICTSSSMNVIFDDSTESFCQDPSKEGLFQEVPVVFEELPVVFEDVAVY
FTREEWAMLDKRQKELYRDVMRMNYELLASLGPAAPKPDLILKLERRAAPWIKDPNGPKW
GKGRPPGKKKTVITNKEVDTLVSTEEARFPLLPSVEVCNSCPSLGNGETEGDMTGKAKKT
YRPRSIQKSWFGQFSWLISDPEENTLFCSACRQHPSLHDKSSRLVKGYTGPFKVETLKYH
EVSKAHKLCVNTAEVKEDAPRTALVPVVPEISSDLMANMEHFFNAAYSIAYHSRPLNDFE
KVLQLLQSTGTMILGKYRNRTACTQFIKYISETLKKEILDNICHSPCVSMLLDSSTDSSD
QSCVGIYIRYFKELEVKESYITLAPLYSETVDGYFETIISALDELDIPFRKPGWVVGLGT
DGSAMLSCKGGLVEKFQEIIPPLLPVHCVAHRLHLAVVDACGNIDLVKKCDRHIRTVFKF
YQSSNKRLNELQVGAAALEQEIVRLKDLNAIRWVASKRRTLNALIVSWPALASHLQSVAE
AGGQIGHRAKGMLKLMMSFHFIKFCHFLLDFLSIFRPVSEVCQKEIVLITEVNSTLERAY
IALETLRCQAGPKEEEFNTNFKEGQLYGIPLDRIEMAEQRFQADRENVILTGIEYLQQRF
DVNGSPQFKNMEVFDTMAWPDGIELINFGNNEILNLAKHFQLSLPQGYSEEGLLDEWLGL
KTIAKNLPFSMLCKNALSQHSRFPLLSQLIAVVVCVPISTSCCERGFSAMSRIKTDERTK
LSNEVINMLMMTAVNGVAVTEYDPQPAIQHWYLTSSGRRFSHVYTCAQVPPHSDTGAELR
NENMRTVYVEEVVSQDPAIHSYGKPVMMPQDYDRNSPNELICSIPAKRPQNCSNRERIFH
EQENQGLPQRDT
Download sequence
Identical sequences F7EJ55
ENSMODP00000003431 XP_007504619.1.35504 ENSMODP00000003431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]