SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003434 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003434
Domain Number 1 Region: 177-256
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.29e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 322-404
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.13e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 3 Region: 408-488
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.21e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 4 Region: 96-168
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000126
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 5 Region: 4-89
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000502
Family Canonical RBD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003434   Gene: ENSMODG00000002822   Transcript: ENSMODT00000003505
Sequence length 506
Comment pep:known_by_projection chromosome:BROADO5:2:541538780:541556102:-1 gene:ENSMODG00000002822 transcript:ENSMODT00000003505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQVLDGLLAQYGTVENVEQVHTDTEAAVVNVTYATRDEARGAIEKLSGHQFENYSFRISY
IPDEDGHAPQRFRRGASSSRERGRSPGGSGQAKPPDFPLRILVPTQFVGAIIGKEGLTIK
NLTKQTQSKVDIHRKENAGASEKPVTIHASPEGSSEACRRILEIMQKEADETKAVEEVPL
KILAHNSLVGRLIGKEGRNLKKIEQDTGTKITISPLQDLTIYNPERTITVKGTIEACSSA
EVEIMRKLREAYENDMLTVNQQGSLIPGLNLSALGIFSTGLSMLPSAAGPRGAAAASYNP
FASHSAYLSGLYGAPQIGVFPHQHPVPEQEVVYLFIPTQAVGAIIGKKGHHIKQLARFAR
ASIKIAPAEGPDVGERMVIITGPPEAQFKAQGRIFGKLKEENFFNPKEEVKLKAHIRVPS
SAAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVKIIGHFFASQTAQRKIREI
VQQVNQQEQKHPQGAALPLPPQQRTK
Download sequence
Identical sequences F7EJ40
ENSMODP00000003434 ENSMODP00000003434 13616.ENSMODP00000003434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]