SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003517 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003517
Domain Number 1 Region: 313-547
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.91e-29
Family PAPS sulfotransferase 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003517
Domain Number - Region: 140-183
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 0.0628
Family Inhibitor of apoptosis (IAP) repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003517   Gene: ENSMODG00000002891   Transcript: ENSMODT00000003594
Sequence length 566
Comment pep:known_by_projection chromosome:BROADO5:3:489141082:489217671:-1 gene:ENSMODG00000002891 transcript:ENSMODT00000003594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKLWVKFQRYFRRKPVRFFTLVALYLTAGSLVFLHSGFVGQPAVAENEPNPAAGAPEGA
ELPYQDLLHLERGFRETPESPNAVRRYGPWLKSSSSKDSPERGRLGDYGGTWSRALKGRV
IREKEEERAKYVGCYLDNPSRRALRGLSFFDYKKMTVFRCQDSCAERGYLYAGLEFGAEC
FCGHKIQGANASQAECNMECKGEKNNICGGVNRLSIYRLELAQESARRYGSAIFRGCFHR
PDNLSLALPVTATMLNMSVDKCVDFCTEKEYPLAALGGKACHCGFPNTRFRLHDQEDEQL
CAQKCGGEEYESCGTPNYFIVYQTQVQDNRCMDRRFLPGQSKELIALASFPGAGNTWARH
LIELATGFYTGSYYFDGSLYNKGFRGERDHWRSGRTICIKTHESGQKEIEAFDAAILLIR
NPYKALMAEFNRKYGGHIGFASQAHWKGKEWPEFVKNYAPWWATHTLDWLKYGKKVLVVH
FEDLKQDLFTQLERMVSLLDVDVFEDRLLCVEGQKDGNFKRSGLRKLEYDPYTPEMQNTI
NSYIKMVDRALKLRNLTGVPDDYYPR
Download sequence
Identical sequences F7B5Z5
ENSMODP00000003517 XP_001376434.2.35504 XP_007490030.1.35504 ENSMODP00000003517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]