SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003545 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003545
Domain Number 1 Region: 2381-2643
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-68
Family Protein kinases, catalytic subunit 0.0000033
Further Details:      
 
Domain Number 2 Region: 1313-1491
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.54e-52
Family DBL homology domain (DH-domain) 0.00000000799
Further Details:      
 
Domain Number 3 Region: 1965-2133
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-45
Family DBL homology domain (DH-domain) 0.0000222
Further Details:      
 
Domain Number 4 Region: 1495-1613
Classification Level Classification E-value
Superfamily PH domain-like 9.38e-33
Family Pleckstrin-homology domain (PH domain) 0.000000529
Further Details:      
 
Domain Number 5 Region: 2272-2368
Classification Level Classification E-value
Superfamily Immunoglobulin 6.85e-23
Family I set domains 0.013
Further Details:      
 
Domain Number 6 Region: 330-466
Classification Level Classification E-value
Superfamily Spectrin repeat 4.56e-21
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 7 Region: 1127-1264
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 8 Region: 877-1030
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-19
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 551-692
Classification Level Classification E-value
Superfamily Spectrin repeat 2.44e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 10 Region: 2137-2202
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000517
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 11 Region: 1664-1755
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000163
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 12 Region: 86-240
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000000405
Family CRAL/TRIO domain 0.01
Further Details:      
 
Domain Number 13 Region: 697-804
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000942
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 14 Region: 244-360
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000038
Family Spectrin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003545   Gene: ENSMODG00000002909   Transcript: ENSMODT00000003622
Sequence length 2686
Comment pep:known_by_projection chromosome:BROADO5:3:111967441:112490545:1 gene:ENSMODG00000002909 transcript:ENSMODT00000003622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSGCGSSTNPAAATASATSSSSSAAASTSTSTSAGGGGNAGEGAEEAAKDLADITAFF
RSEHGLYLSSEACGFRKNDEMKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRI
RQEDLRRLISYLACIPSEEVYKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALII
KPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFEGCLEYNHEEWIEIRVA
FEDYISNATHMLSRLEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEG
QKLLQRIQSSDSFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQC
FQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNIN
RIMSVANRLVESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMS
NVDSWCKACGEVELPSELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPG
SSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVL
DWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGE
CDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVY
AESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIET
VLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTE
DLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQ
DLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASS
LQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQL
MLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPM
ISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQR
ENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELL
KEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYR
TSLEKALGISSDSNKSSKSLQLDIIPASVPGSEVKLRDAAHELNEEKRKSARRKEFIMAE
LIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKEHIIFGNMQEIYEFHNNIFLKEL
EKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSIS
SYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN
IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFT
SELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKG
ALKEPIHIPKTAPTAKQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCE
LTVVIHDFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPCGSLCIA
HSRSSMEMEGIFNHKDSLSVSSNDASPPASVTSLQPHMIGAQSSPGPKRPGNTLRKWLTS
PVRRLSSGKADGHVKKLAHKHKKSREVRKSADAGSQKDSDDSAATPQDETIEERGRNEGL
SSGTLSKSSSSGMQSCGEEEGEEGADSVPLPPPMAIQQHSLLQPDSQDDKTSSRLLVRPT
SSETPSAAELVSAIEELVKSKMALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEM
EERKSSSLKRRHYVLQELVETERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNI
HQIYDWHRDFFLGELEKCLEDPEKLGSLFVKHERRLHMYIVYCQNKPKSEHIVSEYIDTF
FEDLKQRLGHRLQLTDLLIKPVQRIMKYQLLLKSESSSSSNISTMLVTHDYTAVKEDEIN
VYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGYVLGHTSAVIIENPDGTMKKSTS
WHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLTNKVSVKLLNPNYIYDVPPEFIIPL
SEVTCETGETIVLRCRVCGRPKASIIWKGPEHNPLSSNGRYSISYSDLGEATLKIIGVTT
EDDGIYTCIAVNDMGSVSSSASLRVLGPGSDGIMVIWKDNFDSLYSEVAELGRGRFSVVK
KCDQKGAKRSVATKFVNKKLMKRDQVTHELGVMQNLQHPLLIGLLDTFETSTSYVLVLEM
ADQGRLLDCVVRWGNLTEGKIRMYLGEILEAVQYLHNCRIVHLDLKPENILVDQSLAKPT
IKLADFGDAVQLNTTYYIHQLLGNPEFAAPEIILGNPVSLTSDTWSIGVLTYVLLSGVSP
FLDDSVEETCLNICRLDFSFPDDYFKGVSQKAKDFVCFLLRDDPAQRPSAVLSLQDQWLQ
LGNSNSADSLDISRLTSFIERRKHQNDVRPIRSIKNFLQSRLLPRV
Download sequence
Identical sequences F6PN56
ENSMODP00000003545 ENSMODP00000003545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]