SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003584 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003584
Domain Number 1 Region: 400-504
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-19
Family Canonical RBD 0.00067
Further Details:      
 
Domain Number 2 Region: 10-106
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000134
Family Canonical RBD 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003584   Gene: ENSMODG00000002946   Transcript: ENSMODT00000003662
Sequence length 510
Comment pep:known_by_projection chromosome:BROADO5:2:471138215:471161013:1 gene:ENSMODG00000002946 transcript:ENSMODT00000003662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEQVPLSRGCQVPSTPPLPRANRTLLVRHLPAELTAEEKEHLLKHFGAQAVRVLSDK
GRLKHTAFATFPNEKATIKALSRLHQLKVLGHTLVVEFAKEQDQASSFCQTSYSEKKKRS
DEPVEEDKEKKEPSCLTIENGIAPNHGLTFPLNSCLKYLYPPPSSTILANIASALASVPK
FYVQVLHLMNKMNLPTPFGPITARPPMYEEYMPVHVPLPPVPPLPPEEPPMPEEGEGSSG
EESEYESGDDEARERMTKLMELANFQPKRPTTAKQRRVRKRQKIKDMLNIPTSTSHSNLH
PALLPSDVFEQPQPVEHKKIEFNISSGIPTSFVKDLEGEQNSDLSAPGDTTNEGFGKIFP
TPILNDKEEIQEDSDEIPAEFVSRKELEKGRISKEEMETLSVFKSYEPGDPNCRIYVKNL
AKQVEENDLKFIFGRYVDFSSQTERIMFDIRLMKEGRMKGQAFIGFPDEKAAAKALKEAN
GYVLFGKPMVVQFARSARPKQDPKDGKRKR
Download sequence
Identical sequences F6PKA9
ENSMODP00000003584 ENSMODP00000003584 XP_001381889.2.35504 XP_007485106.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]