SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003634 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003634
Domain Number 1 Region: 12-262
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.28e-94
Family CAF1-like ribonuclease 0.000000000903
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003634   Gene: ENSMODG00000002991   Transcript: ENSMODT00000003716
Sequence length 286
Comment pep:novel chromosome:BROADO5:X:22043274:22044378:-1 gene:ENSMODG00000002991 transcript:ENSMODT00000003716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAAHAEQSPRIREVWACNLDEEMKKMRPVIQQYNYVAMDTEFPGVVARPVGEFRSYADY
QYQLLRCNVDWLKIIQLGLTFMNEQGECPPGTSTWQFNFKFNLKEDMYAQDSIELLTMSG
IQFKKHEEEGIEAQYFAELLMTSGVVLCDEVKWLSFHSGYDFGYFIKILTNSPLPEEAHD
FFEILKLFFPVIYDIKYLMKSCRNLRGGLQEVATQLELERIGAQHQAGSDSLLTGMTFFK
MREMFFEDHIDDAKYSGYLYGLGSGATHAYSNSWQNQYGEEISQHS
Download sequence
Identical sequences F6Q4E9
ENSMODP00000003634 ENSMODP00000003634 13616.ENSMODP00000003634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]