SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003636 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003636
Domain Number 1 Region: 411-586
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.8e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000139
Further Details:      
 
Domain Number 2 Region: 588-688
Classification Level Classification E-value
Superfamily E set domains 7.64e-24
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003636
Domain Number - Region: 89-115
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0327
Family Obg GTP-binding protein N-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003636   Gene: ENSMODG00000002992   Transcript: ENSMODT00000003718
Sequence length 902
Comment pep:known_by_projection chromosome:BROADO5:1:173767850:173780895:1 gene:ENSMODG00000002992 transcript:ENSMODT00000003718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAASCEDEELEFKLVFGEEKEAPPLGPGGPGPGEELDTEDSPSCCSLALGEPPPYGASP
IGIPRPPPPRPGMHSPPPRPAPPPGTWESQPARLVRLGGPGGGPGGSGGGRILECPSIRI
TSISPTPEPPPSLEDTPDNWGDGSPRDYPPPDGFGGYREAGGTGSGGSFFSPSPGSSSLS
SWSFFSDASDEAALYTACDEVESELNEAASRFGLGSTLPSPRASPRPWTPDDPWGVYGPS
PGARGPEDSWLLLSAPGPAPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGDEGPEP
PPPPPPPLARDPGSPGPFDYVGATPAESIPQKTRRTSSEQAVALPRPEEPTPCNGKPVPG
GEEAVVPPGPPRKDVPGMDYLAVPSPLSWSKARIGGHSPIFRASALPPLDWPLPSQFEQL
ELRIEVQPRAHHRAHYETEGSRGAVKATPGGHPVVKLLGYNEKPLTLQMFIGTADERNLR
PHAFYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELR
KGETDIGRKNTRVRLVFRVHVPQGGGKVVSVQVASVPIECSQRSAQELPQVEAYNLSACS
VRGGEELVLSGANFLPDSKVVFIERGPDGKLQWEEEATVNRLKSNEVTLTLAVPEYSNKR
VSRPVQVYFYVSNGRRKRSPTQSFKFLPVIFKEEPIPDSSLRGFPSAPGPPFGTDMDFSP
PRAPYSSYPPDDPSYEPPYLSEGFNFGTPPLYPQTGPPSYRPGLRLFPEPSGSPGCPRPP
PPTSFLPRPFPADPYGGGGAPFSMGLPFPPPAAYRPPLPNSPPPEGPFSPQSAHPAAEGY
GEVGSGYGTGEGAPEQEKERGSFGSGFRESVPIQGITLEEVSEIIGRDLSGFPVPPGEEP
PA
Download sequence
Identical sequences F6Q4C9
13616.ENSMODP00000003636 XP_007479945.1.35504 ENSMODP00000003636 ENSMODP00000003636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]