SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003639 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003639
Domain Number 1 Region: 12-262
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.73e-94
Family CAF1-like ribonuclease 0.000000000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003639   Gene: ENSMODG00000002996   Transcript: ENSMODT00000003721
Sequence length 336
Comment pep:novel chromosome:BROADO5:X:21756335:21759347:-1 gene:ENSMODG00000002996 transcript:ENSMODT00000003721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAAHAEQSPRIREVWACNLDEEMKKMRPVIQQYNYVAMDTEFPGVVARPVGEFRSYADY
QYQLLRCNVDWLKIIQLGLTFMNEQGECPPGTSTWQFNFKFNLKEDMYAQDSIELLTMSG
IQFKKHEEEGIEAQYFAELLMTSGVVLCDGVKWLSFHSGYDFGYFIKILTNSPLPEEAHD
FFEILKLFFPVIYDIKYLMKSCRNLRGGLQEVATQLELERVGSQHQAGSDSLLTGMTFFK
MREMFFEDHIDDAKYSGYLYGLGSGATHAYSNSCSGYHRGYYSGYYSGYYRGYHNNLQYV
QYSREPVWRGDQPVFMSIPEMPLFEVEDHQFYTYGE
Download sequence
Identical sequences F6Q499
XP_001363106.2.35504 ENSMODP00000003639 ENSMODP00000003639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]