SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003647 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003647
Domain Number 1 Region: 108-231
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-29
Family SH2 domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003647   Gene: ENSMODG00000003003   Transcript: ENSMODT00000003729
Sequence length 236
Comment pep:novel chromosome:BROADO5:6:29825567:29961236:-1 gene:ENSMODG00000003003 transcript:ENSMODT00000003729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLFSAEFQRQESVKSQNKGVQLYDTPYEPEGNGVDSDSESLVSQRLRESKLPQDDDRPA
DEYDQPWEWNKVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCG
ILGERVDPTVPLEKQIWYHGAISRTDAENLLRLCKECSYLVRNSQTSKHDYSLSLKSNQG
FMHMKLTKAKEKYILGQNSPPFDSVPEVIHYYTTKKLPIKGAEHLSLLYPVAVRTL
Download sequence
Identical sequences F6Q3S2
ENSMODP00000003647 13616.ENSMODP00000003647 ENSMODP00000003647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]