SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003678 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003678
Domain Number 1 Region: 105-215
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.95e-27
Family Canonical RBD 0.0000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003678   Gene: ENSMODG00000003030   Transcript: ENSMODT00000003761
Sequence length 307
Comment pep:known_by_projection chromosome:BROADO5:2:231926789:231930262:1 gene:ENSMODG00000003030 transcript:ENSMODT00000003761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGAQGGRGGGGAQAAARVSRGGGPIRNRP
AMARGGAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSD
ADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQ
LVTSQIDTQRRPAQSVNRGGMTRNRGSGGFGGGGGTRRGSRGGNRGRGRGTGRNSKQQLS
AEELDAQLDAYNARVSTKVGRWGVVSGSRTGLGISPFQQPLSLRDRASQMVEVKHSQTLP
ELPFAVC
Download sequence
Identical sequences F6Q1W2
ENSMODP00000003678 ENSMODP00000003678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]