SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003786 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003786
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.34e-23
Family Canonical RBD 0.0016
Further Details:      
 
Domain Number 2 Region: 104-197
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-22
Family Canonical RBD 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003786   Gene: ENSMODG00000003107   Transcript: ENSMODT00000003870
Sequence length 341
Comment pep:known_by_projection chromosome:BROADO5:1:386012900:386016949:-1 gene:ENSMODG00000003107 transcript:ENSMODT00000003870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVYIGRLSYHVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKDL
CGERVIVEHARGPRRDRDGYSYGSRSGGGGGYSSRRATGRDKYGPPVRTEYRLIVENLSS
RCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLI
EDKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSASKSRSRSKSRSRSKDHSRSR
SKGRKSRSKSKSKAKSDRGSRSRSRSKAKSEKSRSRSRSPSPKENGKGETKSKSRSRSQS
HSNSPQPPPPSKARSESPPVKRATSVSHSRSRSRSRSSSRD
Download sequence
Identical sequences F6PIF7
ENSMODP00000003786 XP_007474254.1.35504 ENSMODP00000003786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]