SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003804 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003804
Domain Number 1 Region: 220-522
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.35e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000336
Further Details:      
 
Domain Number 2 Region: 111-216
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-31
Family SH2 domain 0.000000753
Further Details:      
 
Domain Number 3 Region: 3-106
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-29
Family SH2 domain 0.000000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003804   Gene: ENSMODG00000003120   Transcript: ENSMODT00000003888
Sequence length 593
Comment pep:known_by_projection chromosome:BROADO5:3:496904744:496973201:-1 gene:ENSMODG00000003120 transcript:ENSMODT00000003888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQDLKYD
VGGGEKFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGAMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHF
RTWPDHGVPTDPGGVLDFLEEVHHKQESIPDAGPVVVHCSAGIGRTGTFIVIDILIDIIR
EKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGH
EYTNIKYSLADQTTGDQSPLLPCTPTPTCPEMREDSARVYENVGLVQQQKSFR
Download sequence
Identical sequences F6WVD2
ENSMODP00000003804 XP_001378873.2.35504 ENSMODP00000003804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]