SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003831 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003831
Domain Number 1 Region: 11-167
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.88e-34
Family Canonical RBD 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003831   Gene: ENSMODG00000003146   Transcript: ENSMODT00000003917
Sequence length 214
Comment pep:known_by_projection chromosome:BROADO5:3:490227773:490236538:1 gene:ENSMODG00000003146 transcript:ENSMODT00000003917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDDQSHDNDERIYVENLPADVREKDLEDLFYKYGRIRDIELKNRRGLAPFAFVRFEDPRD
AEDAIYGRNGYDYGQCRLRVELPRNPGGGGPRGRTGPPSRRSEFRVLVSGLPPSGSWQDL
KDHMREAGGVCYADVQKDGMGVVEFLRKEDMEYALRRLDDSKFRSHEGETSYIRVYPERS
TSYGYSRSRSGSRGRDSPYQSRGSPYYTSPYAPY
Download sequence
Identical sequences F6WU16
ENSMODP00000003831 ENSMODP00000003831 13616.ENSMODP00000003831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]