SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003856 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003856
Domain Number 1 Region: 268-437
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000227
Family Ta1320-like 0.068
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003856
Domain Number - Region: 653-686
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0369
Family CCCH zinc finger 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003856   Gene: ENSMODG00000003166   Transcript: ENSMODT00000003942
Sequence length 698
Comment pep:known_by_projection chromosome:BROADO5:5:227480276:227535907:1 gene:ENSMODG00000003166 transcript:ENSMODT00000003942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLVGQAVVVDSGSLLPLGFWSAVAVWVERPHVVNKRLCGSRLEASGRPAWTPLEEATAA
SKGSPQGAELERRDGVGMALGQWEEVQAPGTPLGPPLDPDPPWRNLFRDFVTNDEEVLQF
LRGCRVEKQPEPGSEPEVILRTLIPKPSALCPLPAPKKEMVVKDVFNGTITFLPLEGEKH
LKVKKSNVYQIQLRHNKDEEWCISMFAFCPEKWDSDGVIYPKSSWLGKELLSKLAKWSVK
DKKNEFKSTLSLISLMKYSQIYQELKEKYKEMVKVWPEVTDPEKFVYEDVAIATYLLVLW
EEERAKKGVTEKQSFIDLGCGNGLLVHILSNEGHPGRGIDVRKRKIWNMYGPQTQLEESA
IRPNDSYLFPEVDWLIGNHSDELTPWIPVIAARSSYSCCFFVLPCCFFDFTGKYSRRQSK
KTQYREYLDFIKEVGFTCGFHVEEDCLRIPSTKRVCLIGKSRTYSATEEALVDKQRTEYI
DRRQYSAQIPHIEDSCSSPGSTVETDHCDHHVSLNCLRDEPSKGQFPENERKVPQENGIW
INGFQPRDKIETRNCASLPRDFIDHIVLKVARILIVCFLTSTGSLSLAEVANQLDRETLQ
RLKRECGGLQTLLKNNHQVFEVVNGRVYIRDWREEKAAKKNHPEAKRRLSSEAFKTRLCW
FFIHHPDGCSLTSETCSYAHGVQELRQSQTLKKIKQIQ
Download sequence
Identical sequences F6WDH2
ENSMODP00000003856 ENSMODP00000003856 13616.ENSMODP00000003856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]