SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003931 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003931
Domain Number 1 Region: 80-212
Classification Level Classification E-value
Superfamily Second domain of FERM 3.03e-16
Family Second domain of FERM 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003931   Gene: ENSMODG00000003230   Transcript: ENSMODT00000004017
Sequence length 266
Comment pep:known_by_projection chromosome:BROADO5:Un:74062558:74070609:1 gene:ENSMODG00000003230 transcript:ENSMODT00000004017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AISPLCHNLFALYDEKTKLWYAPNHRIHIEDKTSLRLHYRMRFYFTNWHGTNENEQSVWR
HSPKKQKNGYERRRVLDGTPLLDAHSLEYLFAQGQYDLVKCLAPVRDPKTDQEVHEIENE
CLGMAVLAISHYAMMKSIQLPDLPKDVSYKRYIPETLNRTIRQRNLLTRMRINNVFKDFL
KEFNNKTICDSSVTPHDLKVKYLSTLETLTKHYGAEIFETSLLLISSENEMNKFISKDCG
EVIRYEVMVTGNLGIQWRQKPNVSMS
Download sequence
Identical sequences H9H626
13616.ENSMODP00000003931 ENSMODP00000003931 ENSMODP00000003931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]