SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003964 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003964
Domain Number 1 Region: 5-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-27
Family Ubiquitin-related 0.0000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003964   Gene: ENSMODG00000003254   Transcript: ENSMODT00000004050
Sequence length 81
Comment pep:known_by_projection chromosome:BROADO5:1:173558198:173558733:-1 gene:ENSMODG00000003254 transcript:ENSMODT00000004050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPCLFQTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK
IQGGSVLHLVLALRGGGGLGR
Download sequence
Identical sequences F6T1M0
ENSMODP00000003964 ENSMODP00000003964 13616.ENSMODP00000003964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]