SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003984 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003984
Domain Number 1 Region: 122-218
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-22
Family I set domains 0.0021
Further Details:      
 
Domain Number 2 Region: 220-313
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-20
Family I set domains 0.00055
Further Details:      
 
Domain Number 3 Region: 27-120
Classification Level Classification E-value
Superfamily Immunoglobulin 3.06e-20
Family I set domains 0.00068
Further Details:      
 
Domain Number 4 Region: 315-400
Classification Level Classification E-value
Superfamily Immunoglobulin 8.55e-18
Family I set domains 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003984   Gene: ENSMODG00000003262   Transcript: ENSMODT00000004070
Sequence length 477
Comment pep:novel chromosome:BROADO5:4:405613120:405634268:-1 gene:ENSMODG00000003262 transcript:ENSMODT00000004070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPTLFFLLYLGLCLGQRMRTQAAGEFPRPSLGAEDGSLVPQGRTVTLRCRGSQEADLYR
LEQKLGNGMSDITDMTTVGTEVNFSLPFVTWNHAGTYYCHYRHSLGWSEPSEPLQLVVTG
LYEEPSLAALPSSEVASGQNVTLQCQTRGWHDWFVLYKDGEEITRGMTQSHGRGRHFEFF
FPAVTSSQNGTYRCYSFQSSSPNAWSSPSASLVLRVSDRLPRPSLRAEDGSLVPQGRTVT
LRCRGSQEADLYRLEQKLGNGMPEVTDMTTVGIEVNFSLPFVTWNHAGTYYCHYRHSLGW
SEPSEPLQLVVTGLYEEPSLAALPSSEVASGQAVTLQCQTRGWHDWFVLYKDGEEITRGM
TQSHGRGLLLPAVTSSQNGTYRCYSFQSTSPNAWSSPSPPPGAQDRGQTQGSHISVTNSY
SPDRAAPGYTMGNLVRLTLAGLVLILLGVLLTENWKSSRESLPEHSDQIIPQDRGER
Download sequence
Identical sequences F6T023
13616.ENSMODP00000003984 ENSMODP00000003984 ENSMODP00000003984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]