SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004034 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004034
Domain Number 1 Region: 265-407
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-39
Family Third domain of FERM 0.00049
Further Details:      
 
Domain Number 2 Region: 163-267
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-33
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 81-160
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-25
Family First domain of FERM 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004034   Gene: ENSMODG00000003302   Transcript: ENSMODT00000004120
Sequence length 896
Comment pep:known_by_projection chromosome:BROADO5:6:32471006:32728377:-1 gene:ENSMODG00000003302 transcript:ENSMODT00000004120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFLRRTFGRRSMQRYGRGAAGRAAGRLGDERDGGTRGATSAPLPAAPGGSIFPPGGGP
VLTGGAAVHIPAAGAGKAALYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDLVETDY
FGLQFLDSSQVTHWLDHSKPIKKQMKIGSAYVLHFRIKYYSSEPNNLREEFTRYLFVLQL
RHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQ
KWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVKGRDGCEYALGLTPTGILIFEGANKI
GLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSSRTCKHLWKCAVEHHAFF
RLRTPANNKSNRSDFIRLGSRFRFSGRTEYQATHGARLRRTSTFERRPSKRYPSRRHSTF
KANNPVKAAQLCSKNNPEVHNYQIQYHPNIHPGQPQWHPHSPNISYPLPSPVLNNSNLLL
FNIEENGGTPFTTKAPGRHHHHHHHHQHQHQHQHQHQHQHQHQHHSNYGIPVPLESKEMS
TGIPTPSKLSPGHPILYNETAAHLKKMEMETSKVASPWPALHININKVEEKKVPEKSLQF
PLLPLPVPDQLKCNILKAQIETASKASAQVVKEEPDFANVNKKSTLQDPNVRSPVPSIKV
EATPTATEKQEKQEIKPPRVRKLTRQYSFNHSDEDDLPPALVAAIATTASGPPASPASQK
ISTPQKSEGQNQLSPRAKSPSDTGDVFTLGPGDLLMDFTEATPMAESSSAINPAHSRCYP
QISIQMKEEKNEACMGPPIKTRLIKTFPADTSNPFLDPFTTAPQLIADFGESKLQCKAGQ
SSPLTPKATMRPLAETVSTVQTIFARKPISLPDSAETLRQELEREKMMKRLLMTEL
Download sequence
Identical sequences F7EFR2
ENSMODP00000004034 XP_016279312.1.35504 ENSMODP00000004034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]