SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004035 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004035
Domain Number 1 Region: 356-576
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-51
Family DBL homology domain (DH-domain) 0.00037
Further Details:      
 
Domain Number 2 Region: 717-779
Classification Level Classification E-value
Superfamily SH3-domain 7.74e-16
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 577-702
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000295
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004035   Gene: ENSMODG00000003301   Transcript: ENSMODT00000004121
Sequence length 803
Comment pep:known_by_projection chromosome:BROADO5:4:375113603:375142371:1 gene:ENSMODG00000003301 transcript:ENSMODT00000004121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYRPSPNFQPHLAAFCYGGSQTGPLGAIPGGPTKGREELSPTARHPVAVCQQESLSFAE
LPSPFELGPWPLEVPATSHGLLWPLPVGAQDTRLPTRKPSAFGDDALSEFLGGPRSPQHP
EPQRRTSLSSEKEKSAWRKMRVYQREEADAVFPEVGAGDPQPHPALELPRTLGMAVPSQV
GTKEPERRRFSASELMNRLQSAQRKATFSLRLGKGLTKDRGGVWAAREGRTPEKEQSCLE
TRVDDLVPPAPSGPGERDGCWPGTRPDPVEEAAPKAWIPHERRQSRFLLNSILYQEYSDV
ASDRELQRQKHEEDALVEEAEGEEEGPGPPRANLSPSSSFRAQRSARGSTFSLWQDIPDV
RSSGLLAIIGLQECKLQEARFELITSEASYIHSLSVAVGHFMGSTELAECLGAQEKQWLF
SKLPEVKATSERFLLELEQRLEEDILRFCVCDIVLRHCPAFRRVYLPYVTNQAYQERTYQ
RLLLKNPKFPSILSRLEEAPICQRLPLTSFLILPFQRITRLKMLVENILKRTGQGSRGED
MATKAFNELKKLVQECNASVQSMKRTEELIHLNKKIHFESKIFPLISQSRWLVRHGELVE
LAPSTMPAASATKPKLSSKAIYLHAFNDCLLFSRRKEMGKFAVFLYARMPEIQVKDLSLK
PQGIPGQVFLLQFLQKCQPKNQLLLRAQTESEKRRWISAMCPSSSEEDKDAINENEDIPQ
VQCIKAYKALEPDELTLEKADILAVRTRTSDGWLEGIRLADGERGWVPQAYVDEITSRSA
RLRNIRETRRIESATNKLQGIAA
Download sequence
Identical sequences F7EFQ7
ENSMODP00000004035 ENSMODP00000004035 XP_001377114.1.35504 XP_007491716.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]