SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004262 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004262
Domain Number 1 Region: 389-652
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.17e-72
Family Protein kinases, catalytic subunit 0.0000000014
Further Details:      
 
Domain Number 2 Region: 195-307
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-31
Family SH2 domain 0.000000715
Further Details:      
 
Domain Number 3 Region: 59-184
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-29
Family SH2 domain 0.000000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004262   Gene: ENSMODG00000003486   Transcript: ENSMODT00000004352
Sequence length 669
Comment pep:known_by_projection chromosome:BROADO5:3:460140509:460205999:-1 gene:ENSMODG00000003486 transcript:ENSMODT00000004352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKGHSGPEPERMGHTELLAAYRGLRGGRGVRAPPRRSREQKGLGGALGESTMPDAAAHL
PFFYGSISRAEAEDHLKLAGMADGLFLLRQCLRSLGGYVLSLVYNLTFHHYPIERQLNGT
YAIAGGKPHCGPAELCEFYSKDADGLPCPLRKPCNRPSGLEPQPGVFDSLRDSMVRDYVR
QTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSISREEAERKLYSGTQHDGKFL
LRPRKEHGSYALSLIYGKTVYHYLINQDKSGKYCIPEGTKFDTLWQLVEYLKLKSDGLIY
CLKEICPNASASTASVTAAPTLPVHPSMPRRNDTFNSDGYTPEPARLVNNQGEKSRVLPM
DTSVYESPYSDPEELKDKKLFLKRENLIIDEVELGSGNFGCVRKGVYKMRKKQIDVAIKV
LKSTNEKAEKEEMMKEAHIMHQLDNPYIVRIIGVCKAEALMLVMEMATGGPLNKFLSSKR
GEIPVSNVVELLHQVAMGMKYLEEKNFVHRDLAARNVLLVNQHYAKISDFGLSKALGADD
SYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEAFTYGQKPYKKMKGPEVIK
FIEEGNRMDCPPECPSDMYILMKDCWIYKWENRPGFSDVEQRIRTYYYSLASKAEDVPEA
PQTQEVASA
Download sequence
Identical sequences F7CSQ1
ENSMODP00000004262 ENSMODP00000004262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]