SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004377 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004377
Domain Number 1 Region: 21-84
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000312
Family Canonical RBD 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004377
Domain Number - Region: 132-330
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 0.0305
Family RNA-polymerase beta 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004377   Gene: ENSMODG00000003581   Transcript: ENSMODT00000004470
Sequence length 371
Comment pep:known_by_projection chromosome:BROADO5:4:153668926:153677213:-1 gene:ENSMODG00000003581 transcript:ENSMODT00000004470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIQNVQESKAYERTIIVSNIPVGNFNDEVMAGMLKNYFQEANKFGDVENVTYPTRIKG
GAFVTFQEIKDVENILKKKKHSLIKEGLLPTCLTVSHFSENVIYCICVHLDLSIFGKEVV
LENLVTELKEKIPSLDFCPVQPNGMVIVKGSFLAIKRLKEVLLLMANSLHGNNTNFVSLR
KRKKKKISPVWRTPVSSFQPTMPNTTGKEYIIVLDTNVFNYMKYGNEIYGNTLKEFNIES
KEIVNDDITTLCLRGPQTSSHSNHLEKVKELIEEFSYSLSLELRKETLSLDGKDVEKKQH
IRLACQVLEPQFPQILVKYHSKHIDIIGNSTDTYQFKKLVMKSVGEKKVTSPSTMLLDKM
SKDSQTFPHNQ
Download sequence
Identical sequences F7FQA5
ENSMODP00000004377 ENSMODP00000004377 XP_007494215.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]