SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004383 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004383
Domain Number 1 Region: 5-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-87
Family Protein kinases, catalytic subunit 0.0000000000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004383   Gene: ENSMODG00000003587   Transcript: ENSMODT00000004476
Sequence length 428
Comment pep:known_by_projection chromosome:BROADO5:2:230500798:230583653:1 gene:ENSMODG00000003587 transcript:ENSMODT00000004476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPTTRGLPSTASGRLRGTQDVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQRSREMSSRRLHAARQGARCCP
QRLRRTTY
Download sequence
Identical sequences F7FPX9
XP_007482872.1.35504 ENSMODP00000004383 13616.ENSMODP00000004383 ENSMODP00000004383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]