SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004393 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000004393
Domain Number - Region: 68-187
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000502
Family Canonical RBD 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004393   Gene: ENSMODG00000003594   Transcript: ENSMODT00000004486
Sequence length 284
Comment pep:known_by_projection chromosome:BROADO5:4:153701274:153724306:-1 gene:ENSMODG00000003594 transcript:ENSMODT00000004486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDEMVQTNTNLKIEIKKAEMELQRPSSSYLVKKNIPTKEIKFISAESPKDDSQYSDISCS
FQVTTQLEYELKKGQALITFEDEEVAQNVIKRGKHLVTFGSEEMKLMAKPVPLKTGLSLQ
VHSKISKKKIDVAGIPNELPEEQMRDKLALSFSKSQNGGGEVEHVEYSVNTQRAVITFLK
NGVADNILKHKKYPLFTNTSCYQVDVSPHMKRNVKKLQVFSGISKRTVLLTGLRNIQDDE
ESIEEDIFIHFQKGSNGGGDVEVVKCALKKPQIAYFEADLDQGC
Download sequence
Identical sequences F7FBJ1
ENSMODP00000004393 ENSMODP00000004393 13616.ENSMODP00000004393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]