SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004397 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004397
Domain Number 1 Region: 382-471,564-637
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.82e-32
Family Canonical RBD 0.0000196
Further Details:      
 
Domain Number 2 Region: 688-789
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.36e-25
Family Canonical RBD 0.000063
Further Details:      
 
Domain Number 3 Region: 806-891
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.63e-21
Family Canonical RBD 0.00000999
Further Details:      
 
Domain Number 4 Region: 3-90
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.03e-20
Family Canonical RBD 0.0043
Further Details:      
 
Domain Number 5 Region: 265-350
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-16
Family Canonical RBD 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004397   Gene: ENSMODG00000003597   Transcript: ENSMODT00000004490
Sequence length 936
Comment pep:known_by_projection chromosome:BROADO5:3:495118580:495295824:1 gene:ENSMODG00000003597 transcript:ENSMODT00000004490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLIVKNLPSGMKEERFRQLFAAFGTLTDCSLKFTKDGKFRKFGFIGFKSEEEAQRALD
HFHRSFIDTARVTVEFCKSFGDPSKPRAWSKHSQKTTQPGKPEKSPVAPDTKKDKKKKKA
TGELEKLKKDAEFQEFLMVHQKRTQVATWANDTVGVEPKKEKTKKSDDYLNFDSDSGQES
EEEIDDEDSEKESPAVKAAEQKELSDMDYLKSKVVTADSSEEEEEETSEDEAMACDEEGS
DKEEEQPTPGPRGSKTGPKQPSQAQGEVTAPTTAYTVKLRGAPFNVTEQNVREFLLPLKP
MAIRIVRNAHGNKTGYVFVDFNSEGDVEKALKRNKDYMGGRYIEVFREKGTQGTPTHQKG
NQKAWQGRELKEDEEEEDLADSGRLFVRNLPYTSTEEDLEKLFAKYGPLSEVHYPIDGLT
KKPKGFAFITFMFPEHAVKAYAEVDGQIFQGRMLHLLPSTIKKETSESSDAVSSSYKKKK
ALKDKANSTSSHNWNTLFMGTNAVADAVAQKYNATKSQVFDHETKGSVAVRVALGETELV
QEVRHFLIKNGVSLDSFSQAAGERSRSVILVKNLPSGTRPSELQELFGRFGSLGRVLLPE
GGITAIVEYLEPLEARRGFTSLAYSKFHDVPLYLEWAPIGVFSSHPSPKKEQGDEPGGKE
ATQSEAGPDGETTEEAEKRAAVAPEKKLDAPSEEDDDDDDEEGLPGCTLFIKNLNFSTTE
ETLKEAFSKVGKVKNCSISKKKNKAGVSLSMGFGFVEYQKPEQAQKALKQLQGCMVDDHK
LEVRISERAVKPALTSARQKQVARKQRTSKILVRNIPFQANVREIRELFSTFGELKTVRL
PKKMTGTGPHRGFGFVDFLTKQDAKRAFNALCHSTHLYGRRLVLEWADTEETVQALRRKT
AQHFHDSPKKRRSVVLDEILEQLEEGENEGENEGGE
Download sequence
Identical sequences F7FBF8
ENSMODP00000004397 ENSMODP00000004397 XP_007490058.1.35504 XP_007490059.1.35504 XP_007490060.1.35504 XP_007490061.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]