SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004505 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004505
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily UBA-like 1.87e-30
Family UBA domain 0.000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004505   Gene: ENSMODG00000003674   Transcript: ENSMODT00000004604
Sequence length 1131
Comment pep:known_by_projection chromosome:BROADO5:6:14347163:14445164:-1 gene:ENSMODG00000003674 transcript:ENSMODT00000004604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTSVGSERSRGTRDKTQISTTPMTQPPKQVVQATAEQIRLAQMIYDKNDADFEDKVKQL
MEVTGKNQDESIVALHDCNGDVNRAINILLEGNSDTTSWETVGGKKKSIGKESSENKENR
EKRNDKETNRVRGSNNRRGRGGSRGREFRGEENGVDCNPGDRPSDRGKRGRIRGFGRGRG
RGAGRFSSQGMGTFNPADYTDSSVTDGFGTKPEVWEAGQNDTDDGSEPAQSGHNLAQDLP
RKNNFGLKVISGAWKNSMEEWTTEDWNEDLSETKVFTASSVPAENHVSPGQSIDLVALLQ
KPSTSTQVPEVNSFEPSQQQGFGQALVFTNSQHNTQMASGTSNSSTVNSYSPQSLSSVLG
SGFGELGSSKMANPTGSQILDQLKSPSLGQFSTQSSQQNSTSPPTTTSTWDLKPPVPQSS
IMNQFDFKSQPEPSPVLSQLSQRQQHQTQPIPVPPPGLENFSSQVKLRENSRDNAPAVNK
MLQLPSMSADHQAVSAPQTQPKQIKPPKRRVPPSSKIPVSAVEMPGSADVPGLNVQFGAL
EFGSEPSLPEFGSALSSETSNQAQISLYPKPVSDPLNTSLPISNTVQESTYTTSVITSSS
LTNSSQSTSPVTSSSYDQNSVHSRIAYQSSMAPSETTSIAVTNGHGGVRTQQTLDTTSSV
AAPKTTETSPSLPTLGALPSTASSTTLLPSATPHTATLPSLPQSSDLSSGSLSQLSSSMS
SHQNSLSSASSALSSSTSHTHVSAESAASLQSSTTFSTASASATSTTSSVVSMANSMNTT
NSLGLSVTSVSMPSATSRAAPLVSSGKAPPNLPQGVPPLLHNQYIVGPGGLLPAYPIYGY
DDLQMLQSRLPMDYYGITFPAPATLTGRDGSLANNPYSGDVTKFGRGDSASPAPTTTLAQ
PQQNQSQTHHTAQQPFLNPTLPPGYSYTGLPYYAGVPSAFQYGPTMFVSMEGRQAAPGAG
SSPCIPALRSTEPGSRAVFDALPRGRGPEVSTKGPPRVSSPPKNILAVSAPEKGVSVTSS
NTGVPDIAGSVYNKTQTFDKQGFHAGTPPPFSLPSALGSTGPLTPGAAPGYAPAPFLHIL
PAHQQPHSQMLHHHLQQDGQGGSGQRSQPSTLQPKSQATKPAYGSSPYWTN
Download sequence
Identical sequences F7FAM2
ENSMODP00000004505 13616.ENSMODP00000004505 ENSMODP00000004505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]