SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004518 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004518
Domain Number 1 Region: 202-354
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 92-200
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-24
Family Second domain of FERM 0.0015
Further Details:      
 
Domain Number 3 Region: 6-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-21
Family First domain of FERM 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004518   Gene: ENSMODG00000003688   Transcript: ENSMODT00000004617
Sequence length 980
Comment pep:known_by_projection chromosome:BROADO5:6:222560986:222729408:-1 gene:ENSMODG00000003688 transcript:ENSMODT00000004617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEMTEGRHCQVHLLDDRKLELLVQPKLLSRELLDLVASHFNLKEKEYFGITFIDDTGQS
IWLQLDHRVLDHDLPKKPGPATLYFAVRFYIESISFLKDKTTVELFFLNAKSCVHKGQIE
VESETVFKLAALILQEAKGDYTSDDNARKDLKTLPVFPTQTLQEHPSLAYCEDRVIEHYQ
KIKGLTRGQAIVRYMKIVEALPTYGVHYYGVKDKQGIPWWLGISYKGIGQYDLQDKVKPR
KLFQWKQLENLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANASLIKSIWVMAI
SQHQFYLDRKQSKAKIPSARSLDDIAMDLTDTGTPKVSKMVTLDAKNQFIMASNGSLISS
GSQDSEVSEEQKKEKIMELRKKEKLLQEKLLKKVEELKKICLREAELTGKMPEEYPLNSG
EKPPQVRRRVGTAFKLDDNLLPSEEDPALQELESNFVIQQKLVEAAKKLANEPDLCKNVK
RKRKQDYADAVKKLQEIENAINEYRITCGKKPSQKATLILPEDIIPSESSSLSDTTTYDD
ANDSFTLPAQRSSSVPHSPRIPPPKSLGLERIRFRKSSINEQLMEGRQSREILSTHSSPY
RTLERRPQGGRSMPTTPVLTRNAYSSSHLEPNSSPQHCRQRSGSLESQTHLLSELDGDKP
FFSLSKSQRSSSTEILDDGSSYTSQSSAEYYCVTPSAGPYYATQTLDTRTRGRRRSKKHH
VSTSNSGSMPNLAPKDMRNGGYPKSHDQPPCNYFISGYPPYGECDLYYSGTYVFENDTEG
QYSVNPSYRTSAHYGYDRHKEYRSYHEDEMDRVPHNPYATLRLPRKAPVKSEHITKNIHK
ALVAEHLRGWYQRASGHKDLGHGLQASFDSDRGSQRSLGFSPLQVPCSPSSRASSYTSVS
STTASGNWRTQITLGLADPLSHSSYTSYCGNVYNPLPPPSRQYAEASQLDCTDGSRLEND
MDSNEQRLYWHEDSKPGTLV
Download sequence
Identical sequences F7FAI3
XP_007500129.1.35504 ENSMODP00000004518 ENSMODP00000004518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]