SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004587 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000004587
Domain Number - Region: 634-697
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00124
Family Canonical RBD 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004587   Gene: ENSMODG00000003748   Transcript: ENSMODT00000004687
Sequence length 789
Comment pep:known_by_projection chromosome:BROADO5:1:72799658:73024356:-1 gene:ENSMODG00000003748 transcript:ENSMODT00000004687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPDAERCRPRARKPDMALYVPKARRGSVLPISDHQEISYKHLNAGVNQGQEESHLPPKN
DIFRVSSELQRPSSSPSRQEHKDRDGKRNNSKSKKGTYLKERNRGKFHTPKGTPESKEMF
DKNQQKIPNPSSFSKVPSQIHFKPKKEEKYIDSKASNMTVPQALLISQSSTEIYENQAPT
KQFQSMRLCDFRKKELSGMSYVEELESTVSTNCRVVETVSGSQFFDESENGKSLLNPDYV
LAPTKLNSPSEIVQEIVHTTGDIPKPQTENIKSIASQGSPEDVIFQACTVSGPKNVSDLS
DPMFLSSTAGILDQKNRASLSEIGDPLSNHMHTVSKLENAIDIADLTCMSGESEKNGDPA
YESHMCYEPDHSSAVADESSPGKEPEDDSDITDQACMSVTDDGTDETSVGSNSAVVGGIT
EQACSSVNSLLDCMGVSTYITPLVVANSLECGDESSSSLTVCKDSHSEDNLSSCQESMGR
LVKDLSDCTSVIPIEKTAYSNHGSGLDSGLCVLDKTESFSNEASSSNLDCADDFTESFHN
LRAGEEFKTDEEDVSGKVEYTVSSARQLEPKAPYPSSNDGNVPTEESWDSLFNDDGDCLD
PRLLEELSGSLKNRTSLQEPRFDYFNYEPPEIDISDCELPHVIEIYDFPQEFRTEDLLRV
FCSYQKKGFDIKWVDDTHALGVFSSPITARDALSSKHMMVKIRPLSQATRAAKAKARACA
EFLQPAKARPETSAALARRLVISALGVRSQRTKAERDAELKKLQEAREKKRLEAKQREDI
WEGRDQATV
Download sequence
Identical sequences F7ECQ8
ENSMODP00000004587 XP_001373477.1.35504 XP_007478727.1.35504 XP_007478728.1.35504 XP_007478729.1.35504 XP_007478730.1.35504 XP_007478731.1.35504 XP_007478732.1.35504 XP_016283308.1.35504 ENSMODP00000004587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]