SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004654 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004654
Domain Number 1 Region: 71-159,201-277
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.35e-34
Family Canonical RBD 0.0073
Further Details:      
 
Domain Number 2 Region: 649-728
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.4e-24
Family Canonical RBD 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004654   Gene: ENSMODG00000003801   Transcript: ENSMODT00000004754
Sequence length 730
Comment pep:novel chromosome:BROADO5:3:460359248:460401112:-1 gene:ENSMODG00000003801 transcript:ENSMODT00000004754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVEAAVEVAATESKMEEESGAPGIVSGNGTPTPKSEGERSSQNEKRKEKNVKRGGNR
FEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFK
MEESMKKAAEVLNKHSLSGRPLKVKEDPDGEHARRAMQKVMATTGGMGMGPGGPGMINIP
PSILNNPNIPNEIIHALQAGRLGSTVFVANLDYKVGWKKLKEVFCMAGVVVRADILEDKD
GKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGDFFPPERPQQLPHG
LGGIGMGLGPGGQPIDANHLNKGIGMGNIGPAGMGMEGMGFGINKMGGMEGPFGGGGMEN
MGRFGSGMNMGRMSAFLKKTIQEMRKRIACGRNNRGGGGSVPGIERMGPGIDRIGGAGME
RMGSGLGHGMDRVGSEMERMGLVMDRMGSTVERMGSGIERMGPLGIDHMTTSIERMGQTM
DRIGSGVERMGAGMGFGIERMAAPIDRVGSTIERMGSGVDRMGTTMDRMGLSMDRMVPAG
MGTGIDRMGPVMDRMSTGLDRMGANNMERMGLDRMGANNIERMGLDRMGANNIERMGPTM
GPALGSGMERMGLAMGGSFDRAMEMDRGNFGGSFAGSFGGAGGHVPGVARKACQIFVRNL
PFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFESPEVAERACRMMNGIKLSGR
EIDVRIDRNA
Download sequence
Identical sequences F6ZK16
ENSMODP00000004654 ENSMODP00000004654 13616.ENSMODP00000004654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]