SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004662 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004662
Domain Number 1 Region: 102-165
Classification Level Classification E-value
Superfamily RING/U-box 1.29e-17
Family ZZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 391-440
Classification Level Classification E-value
Superfamily UBA-like 1.28e-16
Family UBA domain 0.00016
Further Details:      
 
Domain Number 3 Region: 16-92
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000466
Family PB1 domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004662   Gene: ENSMODG00000003806   Transcript: ENSMODT00000004762
Sequence length 444
Comment pep:novel chromosome:BROADO5:1:385459498:385471736:-1 gene:ENSMODG00000003806 transcript:ENSMODT00000004762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLTVKAYLMGKEETAREIRRFTLDPVDGPGRCEQLLRRVAEVFPALRPGGFQAYYRDE
DGDLIAFSSDEELGMAMCYIKEDILRIYVKEKKECKREHRPPCVQEVPTNMVHPNVICDG
CNGPVVGNRFKCTICPDYDLCNACEAKGLHKEHNMILFQNPFNHPEWISRRRWLQKMRHG
PNFPAFGGWMPGCWGFFPPDALNQIAAQAQTNRTPPNTGAEQASTSSQQDPNVTFLQNVG
ESVAAALSPLGIDVDIDVEHGGKRSKVTPSFSQPSSEEKGSPQPSSSSSSQSQASTQNSE
MEMTLSEKMQKIILASCMQVDKNPLAQEQTETGNSSGGDDDWTHLSSKEVDPSTGELQSL
QMPESDSTNSMDHSPAGPTGLREAALYPHLPPEADPCLIESLSQMLSMGFSDEGGWLTKL
LQTKNYDIGAALDAIQYSKHAPHP
Download sequence
Identical sequences F6ZJ90
XP_016283670.1.35504 ENSMODP00000004662 ENSMODP00000004662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]