SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004665 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000004665
Domain Number - Region: 2-32
Classification Level Classification E-value
Superfamily UBA-like 0.00204
Family TAP-C domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004665   Gene: ENSMODG00000003808   Transcript: ENSMODT00000004765
Sequence length 244
Comment pep:known_by_projection chromosome:BROADO5:7:77316378:77342425:1 gene:ENSMODG00000003808 transcript:ENSMODT00000004765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFTQAGEKTAIYCLMQNEWKLEVATDNYFQNPDLYYKESMKNSVDKKKLEQLYNRYKDP
QDENKIGIDGIQQFCDDLGLDPAHISVLVIAWKFRAATQCEFSKKEFMDGMTELGCDTTE
KLKALLPRIEQELKDAIKFKDFYQFTFNFAKNPGQKGLDLEMAVAYWNLVLSGRFKFLDL
WNKFLLEHHKRSIPKDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTKGK
RSTF
Download sequence
Identical sequences F6ZJ64
ENSMODP00000004665 ENSMODP00000004665 XP_007501304.1.35504 XP_007501305.1.35504 XP_007501306.1.35504 XP_007501307.1.35504 XP_012401660.1.9362 XP_012401661.1.9362 XP_016280390.1.35504 XP_020820840.1.61212 XP_020820841.1.61212 XP_020820842.1.61212 XP_020820844.1.61212 XP_020820845.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]