SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004703 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004703
Domain Number 1 Region: 18-149
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.9e-37
Family Type II thymidine kinase 0.00000158
Further Details:      
 
Domain Number 2 Region: 151-195
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000333
Family Type II thymidine kinase zinc finger 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004703   Gene: ENSMODG00000003840   Transcript: ENSMODT00000004803
Sequence length 234
Comment pep:novel chromosome:BROADO5:1:329235696:329236400:1 gene:ENSMODG00000003840 transcript:ENSMODT00000004803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCINVPTMLPSSPSKVRGQIQVILGPMFSRKSTELMHRVQRFQIAQYKCLVIKYTKDTR
YSKNFSTHDQNTMEALPACLLWDVAQNALAVTVIGIDEGQFFPDIVEFSETMANAGKTII
VAALDGTFQRKALGNILNLMPLTESMVKLIAVCMECFREAAYTKRLGMEKEVEVIGGADK
YHSVCRLCYFKKVSGQSTGLENKENCPQSGKPGDTTSYQKLFPTQQILQCSSSN
Download sequence
Identical sequences F7EBQ4
ENSMODP00000004703 13616.ENSMODP00000004703 ENSMODP00000004703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]