SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004713 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000004713
Domain Number - Region: 86-140
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0091
Family Hermes transposase-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004713   Gene: ENSMODG00000003848   Transcript: ENSMODT00000004813
Sequence length 162
Comment pep:novel chromosome:BROADO5:Un:101216427:101216915:-1 gene:ENSMODG00000003848 transcript:ENSMODT00000004813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLPTPLNSKSVSRKTLDGILKRIMCEFRLKERHLREQDIQLFCNPFSIDIENVDTIYQIE
LAEVQNCDSLKDTFKSSSLPNFYASLHSETYPNLRNHVLKMATIFGNPYAWEETFSRIKH
LKSPTRSRLTVAYLHHLLWLAVTNMELDIDHLISQKQTHSSH
Download sequence
Identical sequences H9H636
ENSMODP00000004713 13616.ENSMODP00000004713 ENSMODP00000004713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]