SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004743 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004743
Domain Number 1 Region: 125-236
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.73e-27
Family Canonical RBD 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004743   Gene: ENSMODG00000003873   Transcript: ENSMODT00000004844
Sequence length 270
Comment pep:known_by_projection chromosome:BROADO5:1:696115957:696120576:-1 gene:ENSMODG00000003873 transcript:ENSMODT00000004844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWFSISSSLFPPPSKDWLQNALSDPEGLGWGGEGQPPGKMLKICLAEEEEKKEEDALLSL
LDQGKLEETLGPNLELEAIKTKLQKMEEVHERQELKGMEETQHQQPQEEEKEASHLLNPE
KGTPFQGTAMEKVESDQRSVYVGNVDYSGTAKELESHFSCCGEINRVTILCDKYSGHPKG
YAYIEFAHEDSVKTAAELDETTFRGRIIKVLPKRTNFPGISTTNRGGPRNRLSGRGCPPL
RCSLYFGDRLRPRGRSYRGHGRFSQWFEPY
Download sequence
Identical sequences F7DTF3
ENSMODP00000004743 13616.ENSMODP00000004743 ENSMODP00000004743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]