SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004802 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004802
Domain Number 1 Region: 566-654
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-21
Family Third domain of FERM 0.0044
Further Details:      
 
Domain Number 2 Region: 380-473
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-17
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 285-331,509-565
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000342
Family Second domain of FERM 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004802
Domain Number - Region: 26-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00547
Family Ubiquitin-related 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004802   Gene: ENSMODG00000003919   Transcript: ENSMODT00000004905
Sequence length 677
Comment pep:known_by_projection chromosome:BROADO5:1:621122049:621177853:1 gene:ENSMODG00000003919 transcript:ENSMODT00000004905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSSSDFGTTSWELIIRLDHQNEKEQKVFTLRVSGDLHIGGVMLKLVEQINIAQDWSDYA
LWWEQKHCWLLKTHWTLDKYGVQADARLLFTPQHKMLRLRLPNMKTVRLKVSFSSVVFKA
VGDICKTLNIRRSEELSLLKPSDDYFKKKKKKEKNNREPLIEDILNLDNSITSSGSPASP
GLYSKTVTPIYDPVNGTPVSSTITWFSDSPLTGQNCNILAFSQPSCSPETLAEMFQPRSL
IDKAKLNAGWLDSSRSLMEQGIQEDEKLLLRFKYYTFFDLNPKYDAIRINQLYEQARWSI
LLEEIDCTEEEMLIFAALQYHISKLSLSAETLDFTNESEVDEVEAALSNLEVTLEGGKTD
NILEDITDIPKLADYLRLFRAKKLTLKTFKLYWFVFKDTSIAYFKNKDLEQGEPVERLHL
RGCEVVPDVNVSGRKFGIKLLIPVADGMNEVYLRCDNENQYARWMAACILASKGKTMADS
SYWPEVNNILSFLKMKNRNTSSQAPSDPECMDMKPECFVSPRCAKKHKPKQLAARILEAH
QNVAQMSLVEAKLRFIQAWQSLPEFGLTYYIVRFKGSKKDDLLGVSYNRLIRIDMATGDP
ITTWRFANMKQWNVNWEIRKVTIEFDQNVSIAFTCLSADCKIVHEYIGGYIFLSTRSKDQ
NETLDEDLFHKLTGGQE
Download sequence
Identical sequences F6YTW9
13616.ENSMODP00000004802 ENSMODP00000004802 ENSMODP00000004802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]