SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004837 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004837
Domain Number 1 Region: 154-244,303-386
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.05e-46
Family Canonical RBD 0.0000255
Further Details:      
 
Domain Number 2 Region: 57-148
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.57e-29
Family Canonical RBD 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004837   Gene: ENSMODG00000003936   Transcript: ENSMODT00000004940
Sequence length 389
Comment pep:known_by_projection chromosome:BROADO5:6:38999930:39160203:-1 gene:ENSMODG00000003936 transcript:ENSMODT00000004940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLSNGPTCNNTANGPTTINNNCSSPVDS
GNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPK
DAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRI
ITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKTN
QAILSQLYQSPNRRYPGPLAQQAQRFRLDNLLNMAYGVKSRFSPMTIDGMTSLAGINIPG
HAGTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEA
AMAIASLNGYRLGDRVLQVSFKTNKTHKA
Download sequence
Identical sequences F7G9Q7
13616.ENSMODP00000004833 28377.ENSACAP00000017258 ENSMODP00000004837 XP_005294795.1.60341 XP_005294796.1.60341 XP_005294797.1.60341 XP_007427773.1.37977 XP_007498138.1.35504 XP_008101675.1.98722 XP_008101676.1.98722 XP_008101677.1.98722 XP_008101678.1.98722 XP_008166958.1.60341 XP_013916251.1.67126 XP_013916259.1.67126 XP_015672307.1.16292 ENSMODP00000004837 ENSACAP00000017258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]