SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004882 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004882
Domain Number 1 Region: 319-682
Classification Level Classification E-value
Superfamily SIS domain 2.13e-104
Family double-SIS domain 0.000000478
Further Details:      
 
Domain Number 2 Region: 2-209,250-294
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.48e-55
Family Class II glutamine amidotransferases 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004882   Gene: ENSMODG00000003969   Transcript: ENSMODT00000004986
Sequence length 682
Comment pep:known_by_projection chromosome:BROADO5:1:384766588:384821452:1 gene:ENSMODG00000003969 transcript:ENSMODT00000004986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNNEDKERHIKLVKKR
GKVKALDEELYKQDGMDLKVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKTNEFVVIHN
GIITNYKDLRKFLETKGYEFESETDTETIAKLIKYVYDNRESEDIRFSTLVERVIQQLEG
AFALVFKSIHYPGEAVTTRRGSPLLIGVRSKYKLSTEQIPILYRTCNIENVKNICKTRMK
RLDSSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAS
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIIIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTIMALRYCKDRRALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQSRRQEIINGLRCLPEMIKEVLSLDEKIHDLALELYKQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKHMPVIMVIMKDPCF
TKCQNALQQVTARQGRPIILCSKDDTESSKYAYKTIELPHTVDCLQGVLSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences F7FMF5
ENSMODP00000004882 ENSMODP00000004882 XP_007474235.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]