SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004911 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004911
Domain Number 1 Region: 979-1096
Classification Level Classification E-value
Superfamily R3H domain 3.34e-21
Family R3H domain 0.0083
Further Details:      
 
Domain Number 2 Region: 345-414
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000312
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004911   Gene: ENSMODG00000003990   Transcript: ENSMODT00000005015
Sequence length 1121
Comment pep:known_by_projection chromosome:BROADO5:6:13822158:13911761:1 gene:ENSMODG00000003990 transcript:ENSMODT00000005015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAPPVSGTLSVSTDTADFIPHERQNPDLNCRIQRRLESSRIHNRSNNSPPFCQLSSQD
PHHEDSPNQHNYNNQGNKYKSKQSSFQTSSKTPKNHGFQNQQWHKWRSERNYTRGHAIQA
PSDQATGIDVLETATGSESEANPSEPSNVYSSESEKEVASMDHKGAKPKKMAYMTSVSGR
GPKAKGGKSRYEGANRMTPKQKDRVSENMRPVGAVQANSSDTVTEKGAFDVSRNEHKRYL
SRNYPWETVWNKPHPDREIHKIHEGQKNKNARLKNSLSYVTKDKFNERPKKSVGDDRNLA
TTSKSHKKFEMEKSGRRLQKESKAATQLMWNKQNDVPKNKETHTGSLIEQLTTEKYECMV
CCEVVRMMAPVWSCQSCYHVFHLNCIKKWARSPASQAEDAHRGWRCPACQNVSAQVPSTY
TCFCGKVKNPEWNRNEIPHSCGEVCRRKQPGQDCPHSCNLLCHPGPCPSCPAFMTKTCEC
GRTSHSVRCGQSSSIHCSNVCGNILNCGKHNCAELCHAGECQPCGLIVRQVCYCGATSQD
VLCGTDVGQSDEFGDFSCLKICGKKLKCGNHMCSQVCHPQACQLCPRLPQLVQTCPCGQT
PLSKLLELGCVERKTCMDPIPSCGKICGKPLTCGSFDFIHTCENLCHEGDCGPCSRTSVI
SCRCTFRTKELPCASLKTEADATFLCDKRCSKKRSCGRHKCNEICCVDKEHRCSLICGRK
LNCGLHRCEEPCHRGNCQTCWQTSFDELTCFCGESVIFPPVPCGTKPPECKNTCTRLHEC
DHPVFHSCHSEVKCPPCTYLTQKWCMGKHEIRYNIPCHLTEISCGLLCNQLLNCGMHKCK
RICHKGECLIDEVCKQPCTIARIDCNHPCMALCHPSLPCPMSSCKAKVELQCECGRRKET
MVCSEASSTYQRIAAISMATKITDLQLGDSVEISNLITKKEIHETRLHCDEECLALERKR
RLAEALNISESSDPFNVRSGSRYSDSLKEDARKDLKFVSDVEKEMKALVEAVNKGKNAKK
SHCYPPMNRDHRKLIYELAQVYGIESVSYDSEPKRNVVITAVRGKSLCPPTTLTAILERE
IQSRPPPPIPHHKQQTDKNPGSSGVQKVAKEPVIDYFDVQD
Download sequence
Identical sequences F7DSE4
ENSMODP00000004911 XP_007497958.1.35504 ENSMODP00000004911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]