SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004963 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004963
Domain Number 1 Region: 634-1077
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-58
Family Tandem AAA-ATPase domain 0.065
Further Details:      
 
Domain Number 2 Region: 180-210
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000017
Family CCCH zinc finger 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004963
Domain Number - Region: 10-84
Classification Level Classification E-value
Superfamily TPR-like 0.00266
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004963   Gene: ENSMODG00000004034   Transcript: ENSMODT00000005070
Sequence length 1904
Comment pep:known_by_projection chromosome:BROADO5:2:228199476:228466142:-1 gene:ENSMODG00000004034 transcript:ENSMODT00000005070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRRPEKSCEQACESLKRQDYEVAVRHCTEALLSLGQYSLANFTETCPLEVERIKIESL
LYRIASFLQLKNYGQADEDCRHVLGEGLAKGDGSFQAVLCCMHLKGKLQVVSNVLSKSLM
GESLNGMATKDLTRLKTLLTETETATSKVPSEYLMEDLEEGSPNGWHFRPPPRGITSSEE
YTLCKRFLEQGICRYGAQCTSAHSREELTEWQKRYASRLIKLKQQKESKQFSGSYMETLI
EKWMNSLSPEKVLSECVEGVWVEHNPELSLTVNTKKSHQTWTFALTCKPARMLYRVALLY
DAHRPHFSIIGVSAGDSTTQVSQEVPENCQEWIGGKMAQNGLDHYVYKVGVAFNTEIFGT
FRQTIVFDFGLEPVLMQRVMIDAASTEDLEYLMHARQQLLTTAKRWDSTSKTIIDFEPNE
TTDLEKSLLIRYQIPLSADQLFTQSVLDKSLTKTNYQSRLHDLLYIEEIAQYKEVSKFNI
KVQLQIVASFMLTGVSGGAKYAQNGQLFGRFKLTETLSEDTLAGRLVMTKVNAVYLLPII
KEKLVQTQGTKEKVFEAAIEEKTKDYIFLRISRECCEELNLRADCEMQVELQFQLNRLPL
CEMHYALDRIRDNSILFPDVSMTPTIPWSPNRQWDEQLDPRLNAKQKEAVLAITTPLSIQ
LPPVLIIGPYGTGKTFTLAQAVKHILQQQDTRILICTHSNSAADLYIKDYLHPYVEAGNP
QARPLRVYFRNRWVKTVHPVIHQYCLISSTHSTFQMPQKEDILKQRVVVVTLNTSQYLCQ
LDLEPGFFTHILLDEAAQAMECETIMPLALANQNTRIVLAGDHMQLSPFVYSEFARERNL
HVSLLDRLYEHYPTEFPCRILLCENYRSHEAIINYTSELFYEGKLMASGKQPAHKDFYPL
TFFTARGEDVQEKNSTAFYNNAEVFEVVERVEELRRKWPVAWGKLDDGSIGVVTPYADQV
FRIRAELRKKRLSDVNVERVLNVQGKQFRVLFLSTVRTRHTCKHKQTPIKRKEQLLEDST
EDLDYGFLSNYKLLNTAITRAQSLVAVVGDPIALCSIGRCRKFWERFIALCHDNKSLHGI
TFEQIKMQLEALELKKTYVLNPLAPEFIPRALRQQHLGNTIKQQQSPPKGKGHNHNQNEH
FQNEGIVQTNPSVLIGNPIRAYTPPSPLGPHPNMGKSPSPVQRIDPHSGTSILYVPAVYG
GNVVMSVPLPVPWTGYQGRFAVDPRIITHQAAMAYNMNLLQTHGRGSPIPYGLGHHSPVS
VGQQQIQQQEKDQHEQNRNGKNDSNPGPEVNKIRTPEKKSLESKQSDLDSNPQNRSPEAR
PGFAYPNPKFHRKDNLNARHLNLHLTAPHAQYAVPHRHYQHLSQLPRQPFPAQQPQNLDS
VISEQHPTPMLQEVNPLRSTAQPNPVIPSHLNNFIEENPPGLPIGEALERMHGNVALEAL
RQQQARIHQWSEHNAYLTQGSLPYAHYHHPHLQHLSQPPAGLHQHPIRANWKLATNAEDE
AKATHARFQDLIRELAHHDQSETRELTEMPPPQSRLLQYRQVQTRSPPANTSSSNSNHSG
HFSNFSDNIREIEMANNPAFQQHLPPQIYNSSFSIPSENLTPTPLKYLPPDGSWTFANLH
QNHLMGQGFHYSIPPLPHRPQQNPFIQIQNQHVVGQEPFHPLSSRVVSASSLHSLEEGDR
LESTSLVVSPSNHVIKQLFPTVLPLNVYEPRGPGRPLYQRRISSSSVPPCSEELNTPQDS
LAQCKEHQDHNNRSSFNYSSPELWVNTTSSAPPQNIPCNGSSRTAPPRELLAPSKPLKSS
EDHLKSENLQLSNSFNYSMLQHLGQFPPLMPNKQIVESNSNSQPSSGGNKPTMSYASALR
APPKPKPPPEQAKKKSDPLSLFQELGLGRSSDCCRKTSFGRRAN
Download sequence
Identical sequences F7CMF0
ENSMODP00000004963 ENSMODP00000004963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]